ABOUT THIS EXAMPLE:

This example shows how the (sequence) information contained in a CIF file can be readily accessed and transformed into another format. This particular example implements a FASTA converter, which reads the monomer sequences in the entity_poly_seq category and translates them into the single-letter FASTA format. As there are single-letter codifications already in the CIF file, in the entity_poly category, this example also shows how one might easily compare their translations with the codifications already in the CIF file.

BUILD INSTRUCTIONS:

FILES: FASTA.C, 5HVP.cif
	    Save FASTA.C to /path/to/cifparse-obj-vX.X-prod-src/parser-test-app-vX.X/src/
	    Save the CIF file anywhere, e.g., /path/to/cifparse-obj-vX.X-prod-src/parser-test-app-vX.X/bin/
	    Add FASTA.ext to the BASE_MAIN_FILES list in the Makefile in /path/to/cifparse-obj.vX.X-prod-src/parser-test-app-vX.X
	    Execute make in the same directory as the Makefile
	    cd to bin, where the executable has been made, and run ./FASTA /path/to/5HVP.cif, which generates /path/to/5HVP.fasta
	  

Functions of Note

#include "CifFile.h"
string CifFile::GetFirstBlockName() ►
Returns the first data block name. CifFile inherits this method from TableView. Related: CifFile::GetBlockNames(vector<string>& blockNames).
Block& CifFile::GetBlock(const string& blockName) ►
Retrieves a data block specified by some blockName. CifFile inherits this method from TableView.
ISTable& Block::GetTable(const string& name) ►
Retrieves a table (i.e., category) within the block, specified by some name.
#include "ISTable.h"
bool ISTable::IsColumnPresent(const string& colName) ►
Returns a bool indicating whether or not the column colName is present in the table.
const string& operator()(const unsigned int rowIndex, const string colName) ►
Returns the value of the attribute colName at row index rowIndex
unsigned int ISTable::GetNumRows() ►
Returns the numbers of rows in the table (i.e., category).

Basic Sample Output

./FASTA 5HVP.cif
For entity #1:

The codified version in the CIF file is as follows:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF

The codified version obtained from translating entity_poly_seq is as follows:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF

The two are equivalent.
---
For entity #2:

The codified version in the CIF file is as follows:
XVVXAX

The codified version obtained from translating entity_poly_seq is as follows:
XVVXAX

The two are equivalent.
---
more 5HVP.fasta
>HIV-1 PROTEASE
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
>ACETYL-*PEPSTATIN
XVVXAX

/*************************
* FASTA.C
*
* For some CIF file, generate a FASTA file based on the monomer sequences
* stored in the struct_poly_seq category table. Optionally compare our
* codification with the one stored in the struct_poly category table.
*
* Lines with superscriptions contain footnoted references or explanations.
*************************/

#include <fstream>
#include <cstring>
#include <iostream>
#include <map>
#include <string>
#include <vector>

#include "CifFile.h"
#include "CifParserBase.h"
#include "ISTable.h"

#include <boost/assign/list_of.hpp>

#define COL_WIDTH_MAX 80

// Holds amino acid codification information
std::map<string, char> codification;

char identifyMonomer(const string& monomer);
void prepareCodes();
void showUsage();

int main(int argc, char **argv)
{
    if (argc != 2)
    {
        showUsage();
    }

    // The name of the CIF file
    string cifFileName = argv[1];

    // Parsing diagnostics
    string diagnostics;

    // Compare our codifications with those contained in the CIF file
    bool compare (true);

    // Create CIF file and parser objects
    CifFile *cifFileP = new CifFile;
    CifParser *cifParserP = new CifParser(cifFileP);

    // Parse the CIF file
    cifParserP->Parse(cifFileName, diagnostics);

    // Delete the CIF parser, as it is no longer needed
    delete cifParserP;

    // Display any diagnostics
    if (!diagnostics.empty())
    {
        std::cout << "Diagnostics: " << std::endl << diagnostics << std::endl;
    }
  
    // Fill the codification map
    prepareCodes();

    // Get the first data block name in the CIF file
    string firstBlockName = cifFileP->GetFirstBlockName();

    // Retrieve the first data block
    Block &block = cifFileP->GetBlock(firstBlockName);

    // Retrieve the entity category table, which contains information that will be used in the FASTA1
    ISTable& entity = block.GetTable("entity"); 
	
    // Holds non-mandatory entity attributes that could serve as FASTA header lines, ordered preferentially
    string candidates[] = {"pdbx_description", "details", "type"};
	
    // The entity category table attribute to be used to fill the FASTA header
    string headerDescriptor;
	
    // Find the first present candidate
    for (unsigned int i = 0; i < 3; ++i)
    {
        if (entity.IsColumnPresent(candidates[i]))
        {
            headerDescriptor = candidates[i];
            break;
        }  
    }

    // If none of the optional descriptors are present, just use the entity id
    if(headerDescriptor.empty())
    {
        headerDescriptor = "id";
    } 

    // Retrieve the entity_poly_seq category group table, which contains the monomer sequences for entities2
    ISTable& entity_poly_seq = block.GetTable("entity_poly_seq"); 
   
    // Use the CIF file name to generate the FASTA file name
    size_t fileExtPos = cifFileName.find(".cif");
    string outFileName = cifFileName.substr(0, fileExtPos) + ".fasta";

    // Create and open the FASTA file
    std::ofstream outFile;
    outFile.open(outFileName.c_str());

    // Container to hold each codified entity for optional comparison
    vector<string> codifiedEntities;
	
    // Keep track of the current column width and current entity id
    unsigned int columnWidth (0), entityID (1);

    // Holds the codification of the current entity
    string codifiedEntity;

    // Write the header to the FASTA file
    outFile << ">" << entity(entityID - 1, headerDescriptor) << std::endl;

    for (unsigned int i = 0; i < entity_poly_seq.GetNumRows(); ++i, ++columnWidth)
    {
	
        // Obtain the ID of the entity described by this row
        unsigned int currentEntityID = atoi(entity_poly_seq(i, "entity_id").c_str());

        // If we are dealing with a new entity
        if (currentEntityID != entityID) 
        {
            // Write out the current entity's FASTA codification
            outFile << codifiedEntity;
			
            // Store the current entity's FASTA codification
            codifiedEntities.push_back(codifiedEntity);

            // Set the new entity ID
            entityID = currentEntityID;
         
            // Write out the new header
            outFile << "\n>" << entity(entityID - 1, headerDescriptor) << std::endl;
         
            columnWidth = 0;
            codifiedEntity.clear();
        }

        // If we have hit the maximum column width
        if (columnWidth == COL_WIDTH_MAX)
        {
            // Move to a new line and reset the width
            codifiedEntity += "\n";
            columnWidth = 0;
        }

        // Retrieve the monomer stored in this row 
        string monomer = entity_poly_seq(i, "mon_id");
        
        // Identify the monomer and add its codification
        codifiedEntity.push_back(identifyMonomer(monomer));
    }
	
    // Write out and store the last entity
    outFile << codifiedEntity;
    codifiedEntities.push_back(codifiedEntity);	

    // Close the FASTA file as we have no more monomers to read
    outFile.close();

    // Optional comparison against the codified sequences stored in entity_poly
    if (compare)
    {   
        // Retrieve the table corresponding to the entity_poly category, which contains one-letter
        // codified canonical sequences for entities, against which we can compare our conversions3
        ISTable& entity_poly = block.GetTable("entity_poly");
		
        for (unsigned int i = 0; i < codifiedEntities.size(); ++i)
        {
            string temp = entity_poly(i, "pdbx_seq_one_letter_code_can");
            std::cout << "For entity #" << i + 1 << ":" << std::endl << std::endl;
            std::cout << "The codified version in the CIF file is as follows: " << std::endl << temp << std::endl << std::endl;
            std::cout << "The codified version obtained from translating entity_poly_seq is as follows: " << std::endl 
                << codifiedEntities[i] << std::endl << std::endl;
            int comparison = codifiedEntities[i].compare(temp);
            string equality = (!comparison) ? "equivalent" : "inequivalent";
            std::cout << "The two are " << equality + "." << std::endl << "---------------" << std::endl;
        }
    }
    return 0;
}

char identifyMonomer(const string& monomer)
{
    char code;

    // If we are dealing with an amino acid 
    if (monomer.length() == 3)
    {
        // Find its codification in the map, using 'X' if it is not found
        code = (codification.find(monomer) != codification.end()) ? codification[monomer] : 'X';
    }

    // If we are dealing with a nucleic acid, there is nothing to codify
    else
    {
        code = monomer[0];
    }

    return code;
}

void prepareCodes()
{
    codification = boost::assign::map_list_of
        ("ALA", 'A')
        ("CYS", 'C')
        ("ASP", 'D')
        ("GLU", 'E')
        ("PHE", 'F')
        ("GLY", 'G')
        ("HIS", 'H')
        ("ILE", 'I')
        ("LYS", 'K')
        ("LEU", 'L')
        ("MET", 'M')
        ("ASN", 'N')
        ("PYL", 'O')
        ("PRO", 'P')
        ("GLN", 'Q')
        ("ARG", 'R')
        ("SER", 'S')
        ("THR", 'T')
        ("SEC", 'U')
        ("VAL", 'V')
        ("TRP", 'W')
        ("TYR", 'Y');
}

void showUsage()
{
    std::cout << "Usage: ./FASTA /path/to/file.cif" << std::endl;
    exit(1);
}

NOTES AND REFERENCES

  1. http://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v40.dic/Categories/entity.html
  2. http://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v40.dic/Categories/entity_poly_seq.html
  3. http://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v40.dic/Categories/entity_poly.html